DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and Micu2

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_599223.2 Gene:Micu2 / 171433 RGDID:619739 Length:431 Species:Rattus norvegicus


Alignment Length:412 Identity:111/412 - (26%)
Similarity:188/412 - (45%) Gaps:77/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AGSDLHLHEGKKIREKVGFRERKIIEYENR-----IRQFSTPDKVFRYFATIQVPVADDRH--EV 197
            ||:....|.|   |.|...||..:.....:     |.:.|...:.|..|::::       |  |.
  Rat    45 AGAGAAWHHG---RVKAAARESTLTGLVQKNDLGPIEKLSLRKQRFMQFSSLE-------HDGEY 99

  Fly   198 YMTPTDFLTSMTPGMKQPDGLGLDQYRRYDPKSVGEQL-NLHLEK-----------NSIFYKLGS 250
            ||||.|||.|:             .:.|.|.|::.::| ...:|.           ::.|..||.
  Rat   100 YMTPRDFLFSV-------------MFERMDRKTLVKKLAKKDIEDVLSGIQTARCGSTFFRDLGD 151

  Fly   251 YGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQ---TSMGTRHRD 312
            .|:|::::|:||||:|:.....|.:||:|.|.:|:..::.:||..:..::.:|   .::.|...:
  Rat   152 KGVISYTEYLFLLTILTKPHSGFHVAFKMLDADGNEMIERKEFVKLQKIISKQDGFKTVKTNEIE 216

  Fly   313 HANTGNTFKGVNSALITYFFGPNMDEKLTIEKFLDFQEQLQREILSLE---------FERKEPND 368
            :........|:|:.|...|||...::||..::|..|.|.||.|:..:|         |.|||   
  Rat   217 YQEPTVNEPGLNTTLQVRFFGKRGEKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKE--- 278

  Fly   369 EGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGKGISKQDYLDFFHFLNNINDVDTALT 433
                   ||||.||.:..  .:.|....|.|:.:. ..|:.||..::..|.||..::.|...|:.
  Rat   279 -------DFAEWLLFFTN--SENKDIYWKNVREKL-SVGESISLDEFKSFCHFTTHLEDFAIAMQ 333

  Fly   434 FYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEK 498
            .:.:|...:.....:...|......||::::|.||.|||.:.|..||:.||:.|:|||:.|||  
  Rat   334 MFSLAHRPVRLAEFKRAVKVATGQELSNNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGL-- 396

  Fly   499 PKDTGFLKMMRSV---FKCAKE 517
                 ::...:||   :||.|:
  Rat   397 -----WVSQQQSVQEYWKCVKK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 14/40 (35%)
EF-hand_8 438..491 CDD:290545 17/52 (33%)
Micu2NP_599223.2 EFh_MICU2 173..392 CDD:320082 64/231 (28%)
EF-hand motif 173..202 CDD:320082 8/28 (29%)
EF-hand motif 230..260 CDD:320082 11/29 (38%)
EF-hand motif 326..355 CDD:320082 4/28 (14%)
EF-hand motif 363..392 CDD:320082 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54184
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.