DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and micu2

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002940795.2 Gene:micu2 / 100486652 XenbaseID:XB-GENE-994925 Length:431 Species:Xenopus tropicalis


Alignment Length:414 Identity:112/414 - (27%)
Similarity:182/414 - (43%) Gaps:94/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SESEDSEDEEAGSDLHLHEGKKIREKVGFRERKIIEYENRIRQFSTPDKVFRYFATIQVPVADDR 194
            ::.||:.||       ..|.:.|| |..|.:...::||.                          
 Frog    66 AQKEDANDE-------AKENQSIR-KQRFMQFASLKYEG-------------------------- 96

  Fly   195 HEVYMTPTDFLTSMTPGMKQPDGLGLDQYRRYDPKSVGEQLN-----------LHLEKNSIFYK- 247
             |.||||.|||.|:             .:.:.:.:::.:.|.           ...:..|:|:: 
 Frog    97 -EYYMTPRDFLFSV-------------MFEQMERRTISKPLTKKELDAMLSQATKAKPGSMFFRD 147

  Fly   248 LGSYGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSM-----G 307
            ||..|||::::|:||||:|:..:..|.|||.|.|.:|:..|:..||..:..::..:..|     |
 Frog   148 LGDKGLISYTEYLFLLTILTKPQTGFRIAFNMLDTDGNEQVEKREFFKLQRILGHKEDMKMSPGG 212

  Fly   308 TRHRDHANTGNTFKGVNSALITYFFGPNMDEKLTIEKFLDFQEQLQREILSLE---------FER 363
            .......:|.::  .||:.|:.:|||....|||...:|..|.|.||.|:..:|         |.|
 Frog   213 VTSTQEPSTDSS--DVNTTLLVHFFGRGGREKLQYSEFYKFMENLQTEVQEMEFIQFSKGLNFMR 275

  Fly   364 KEPNDEGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGKGISKQDYLDFFHFLNNINDV 428
            ||          ||||.||.:...  :......:.|:.|. ..|:.||..::..|:.|:||:.|.
 Frog   276 KE----------DFAEWLLFFTDE--ENNDVYWQNVQARI-PPGESISMDEFKSFYQFMNNLEDF 327

  Fly   429 DTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQ 493
            ...:..:..|..:|.....:...|......||::|:|.||.|||.:.||.||:.||:.|::||:.
 Frog   328 SITMKLFSSANRAIKMAEFKRAVKVATGQELSNNVLDTVFKIFDLDGDNCLSHGEFLGVLRNRLH 392

  Fly   494 RGLEK-PKDTGFLKMMRSVFKCAK 516
            |||:. |:..|    :...:||.|
 Frog   393 RGLKHVPQQQG----VHGYWKCVK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 17/40 (43%)
EF-hand_8 438..491 CDD:290545 19/52 (37%)
micu2XP_002940795.2 EFh_MICU2 172..391 CDD:320082 69/233 (30%)
EF-hand motif 172..201 CDD:320082 10/28 (36%)
EF-hand motif 229..259 CDD:320082 12/29 (41%)
EF-hand motif 325..354 CDD:320082 4/28 (14%)
EF-hand motif 362..391 CDD:320082 15/28 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.