DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and Vegfa

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_114024.2 Gene:Vegfa / 83785 RGDID:619991 Length:393 Species:Rattus norvegicus


Alignment Length:425 Identity:82/425 - (19%)
Similarity:139/425 - (32%) Gaps:120/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 DREKEAVKKP--HITTTSTTTTTSTTSTVKPTIMRTERPK--------------------LQLID 326
            ||:.:....|  |:......|..:..|       |.:.||                    :||:.
  Rat     3 DRQTDTAPSPSAHLLAGGQPTVDAAAS-------REQEPKPAPGGGVEGVGARGIARKLFVQLLG 60

  Fly   327 ANLKN------GGGEEDDSNEDSDSESEEGFSNEQWNKIEHQHHLRQQKHQKELLAMREKSRNTP 385
            ::|..      .||:...:...:.|..|:....::..|     ...:::..:..|..||....|.
  Rat    61 SSLSGVAVVCAAGGKPIGAGRSASSGLEKPGPEKRGEK-----EKEEERGPQWALGSREPGSWTG 120

  Fly   386 LIRNIENEVSAAKTLEDNDGHDVENIYARNYVAAKVGQKK-EDQLGTPEAVIKARRLHAQKQKSE 449
            ......:...||:         .....||..|....|.:: ..:.|.|.:  .:||..|.:....
  Rat   121 EAAVCADSAPAAR---------APQAPARASVPEGRGARQGAQESGLPRS--PSRRGSASRAGPG 174

  Fly   450 RA--------------------LAHAHMNQ-------------------VLKEATCRIPQKRCQL 475
            ||                    |.||..:|                   |.:.:.||..:....:
  Rat   175 RASETMNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDI 239

  Fly   476 VQQDPSK---IYTPHCTILHRCSEDSGCCPSRSQICAAKSTHNVELHFFVKSSKHRSV-IEKRTF 536
            .|:.|.:   |:.|.|..|.||   :|||...:..|...|..||.:. .::...|:|. |.:.:|
  Rat   240 FQEYPDEIEYIFKPSCVPLMRC---AGCCNDEALECVPTSESNVTMQ-IMRIKPHQSQHIGEMSF 300

  Fly   537 VNHTECHCIERS--TYNEETAMAHYGQSVVRA------TILSCTCPKSFEK----ILQDDGQCRC 589
            :.|:.|.|..:.  |..|:.::...|:...|.      ...|..|....|:    .:||...|:|
  Rat   301 LQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKC 365

  Fly   590 DCSSGNYDCDWLKRGNEHFAMNDRKCIQQGRCKPP 624
            .|.:.:..|.     .....:|:|.|    ||..|
  Rat   366 SCKNTDSRCK-----ARQLELNERTC----RCDKP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 24/86 (28%)
VegfaNP_114024.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.