DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and pdgfbb

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_005171668.1 Gene:pdgfbb / 796490 ZFINID:ZDB-GENE-131121-332 Length:483 Species:Danio rerio


Alignment Length:328 Identity:67/328 - (20%)
Similarity:105/328 - (32%) Gaps:94/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 APTGGHRSPHQQQRLQQLQEAQQLEAHQQHHHHLRHEQHLRAELEGNHQPPIEDVEKKAFLDPQL 93
            ||...||.....|:|.....:::...        :.:.|.|.||:.|.:..:||:          
Zfish   172 APRPAHRRKSSSQKLDARDRSEKSRP--------KEDLHRRDELKHNQRLNLEDL---------- 218

  Fly    94 PMQQHHLRHHNRHHASWEQRVFPSLRHQQHRLSIGPST---AKNLMTTEAPTTRHHGLISNHSRY 155
                  |.|      ||    .|     |.|.|..|.|   .::..|..  .|::.|..|:|...
Zfish   219 ------LSH------SW----LP-----QDRFSESPDTVHFGRDAWTRN--ETQYGGGKSHHRHP 260

  Fly   156 FD-RDGIFPSWAEPRTTRG-----PNWRQEVDSSDSDEDSDEDDEDDYDEYDEDGDTS---NGVD 211
            .| |.   .|.....:|:|     ||..::.::..|..:..:.:..:|...:....||   |||.
Zfish   261 VDVRK---HSTTNDTSTQGTMAPIPNHTEQEETDTSLRNITQIESQNYTNRNITNQTSEFNNGVS 322

  Fly   212 EELARQMPRYSLFTQKLPHIDLKDTDYNAYDQSDELDIVSSSNRN-SNKYPSVANPHDKSAGKR- 274
            |...:.....|..||....:...:..|:        :...::|.| .:.:.||.....|..|:. 
Zfish   323 ETTNQTFKHQSNLTQLNEQLRTMNRTYS--------NATETANLNRGDVFVSVEESVKKLRGETT 379

  Fly   275 --------NIFDWLFKHDREKEAVKKPHITTTST--------------------TTTTSTTSTVK 311
                    ...|.|..|....|...|||:....|                    |||..|..|..
Zfish   380 DVEKVKVDEAEDLLLLHKLMDEEKHKPHLKVQQTNVQPDKKLQQLHHKQQQHTYTTTQRTAGTTS 444

  Fly   312 PTI 314
            |.:
Zfish   445 PPL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079
pdgfbbXP_005171668.1 PDGF 86..169 CDD:306779
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.