DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and VEGFB

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_003368.1 Gene:VEGFB / 7423 HGNCID:12681 Length:207 Species:Homo sapiens


Alignment Length:104 Identity:24/104 - (23%)
Similarity:39/104 - (37%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 AHAHMNQVLK------EATCRIPQKRCQLVQQ---DPSKIYTPHCTILHRCSEDSGCCPSRSQIC 508
            |..|..:|:.      .|||:..:....|..:   ..:|...|.|..:.||   .||||.....|
Human    28 APGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRC---GGCCPDDGLEC 89

  Fly   509 AAKSTHNVELHFFV---KSSKHRSVIEKRTFVNHTECHC 544
            .....|.|.:...:   .||:    :.:.:...|::|.|
Human    90 VPTGQHQVRMQILMIRYPSSQ----LGEMSLEEHSQCEC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 21/87 (24%)
VEGFBNP_003368.1 PDGF 45..126 CDD:197537 21/87 (24%)
PHA03269 108..>188 CDD:165527 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..207 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.