DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and VEGFA

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001020537.2 Gene:VEGFA / 7422 HGNCID:12680 Length:412 Species:Homo sapiens


Alignment Length:373 Identity:67/373 - (17%)
Similarity:106/373 - (28%) Gaps:117/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 ANLKNGGGEEDDSNEDSDSESEEGFSNEQWNKIEHQHHLRQQKHQKELLAMREKSRNTPLIRNIE 391
            |...:.|.||....|..:.|.:|.....||.                 |..|:....|.......
Human    80 ARSASSGREEPQPEEGEEEEEKEEERGPQWR-----------------LGARKPGSWTGEAAVCA 127

  Fly   392 NEVSAAK---TLEDNDGHDVENIYARNYVAAKVGQKKEDQLGTPEAVIKARRLHAQKQKSERA-- 451
            :...||:   .|....|.           ..:|.::..::.|.|.:  .:||..|.:....||  
Human   128 DSAPAARAPQALARASGR-----------GGRVARRGAEESGPPHS--PSRRGSASRAGPGRASE 179

  Fly   452 ------------------LAHAHMNQ--------------------VLKEATCRIPQKRCQLVQQ 478
                              |.||..:|                    |.:.:.|...:....:.|:
Human   180 TMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQE 244

  Fly   479 DPSK---IYTPHCTILHRCSEDSGCCPSRSQICAAKSTHNVELHFFVKSSKHRSVIEKRTFVNHT 540
            .|.:   |:.|.|..|.||   .|||......|......|:.:............|.:.:|:.|.
Human   245 YPDEIEYIFKPSCVPLMRC---GGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN 306

  Fly   541 ECHCIERS--TYNEETAMAHYGQSVVRATILS-------------CTCPKSF------------- 577
            :|.|..:.  ...|:.::...|:...|....|             |..|.|.             
Human   307 KCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR 371

  Fly   578 -EKILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDRKCIQQGRCKPP 624
             ...:||...|:|.|.:.:..|.     .....:|:|.|    ||..|
Human   372 KHLFVQDPQTCKCSCKNTDSRCK-----ARQLELNERTC----RCDKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 19/85 (22%)
VEGFANP_001020537.2 PDGF 230..312 CDD:197537 19/84 (23%)
VEGF_C 364..412 CDD:291235 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.