DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfab

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001315526.1 Gene:vegfab / 558154 ZFINID:ZDB-GENE-030131-4605 Length:252 Species:Danio rerio


Alignment Length:223 Identity:54/223 - (24%)
Similarity:83/223 - (37%) Gaps:71/223 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 QVLKEATCRIPQKRCQLVQQ----DPSKIYTPHCTILHRCSEDSGCCPSRSQICAAKSTHNVELH 519
            :|..::.|| |::....:||    |...|:.|.|.:|.||   :|||......|....|:|:.|.
Zfish    42 EVYNKSLCR-PREMLVEIQQEYPDDTEHIFIPSCVVLTRC---AGCCNDEMMECTPTVTYNITLE 102

  Fly   520 F-FVKSSKHRSVIEKRTFVNHTECHC---------IE-----------RSTYNEE---------- 553
            . .:|..:|:..| ..:|..|:||.|         ||           :...|.|          
Zfish   103 IKRLKPLRHQGDI-FMSFAEHSECQCRMKKDLPKEIEKKPRKGKGQKRKGKKNREKKRDLCMAPS 166

  Fly   554 --TAMAH----------YGQSVV----RATILSC-----TCPKSFEKI-LQDDGQCRCDCSSGNY 596
              |:..|          .|::||    .:.|..|     ||.:...:: :||...|:|.|.....
Zfish   167 CLTSAIHTLQPSLWTLRRGKTVVPDQGGSKISQCEPCCSTCSERRRRLFVQDPETCQCSCKHSEA 231

  Fly   597 DCDWLKRGNEHFAMNDRKCIQQGRCKPP 624
            ||     .:....:|:|.|    ||..|
Zfish   232 DC-----RSRQLELNERTC----RCDKP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 29/107 (27%)
vegfabNP_001315526.1 PDGF 49..127 CDD:366040 26/82 (32%)
VEGF_C 204..252 CDD:317016 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.