DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and PGF

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_002623.2 Gene:PGF / 5228 HGNCID:8893 Length:170 Species:Homo sapiens


Alignment Length:90 Identity:26/90 - (28%)
Similarity:42/90 - (46%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 QVLKEATCRIPQKRCQLVQQDPSKI---YTPHCTILHRCSEDSGCCPSRSQICAAKSTHNVELHF 520
            :|...:.||..::...:|.:.||::   ::|.|..|.||   :|||...:..|....|.||.:..
Human    45 EVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRC---TGCCGDENLHCVPVETANVTMQL 106

  Fly   521 F-VKSSKHRSVIEKRTFVNHTECHC 544
            . ::|....|.:| .||..|..|.|
Human   107 LKIRSGDRPSYVE-LTFSQHVRCEC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 25/85 (29%)
PGFNP_002623.2 PHA02661 4..134 CDD:177444 26/90 (29%)
PDGF 50..132 CDD:197537 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.