DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfc

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_991297.1 Gene:vegfc / 403049 ZFINID:ZDB-GENE-040303-4 Length:396 Species:Danio rerio


Alignment Length:322 Identity:69/322 - (21%)
Similarity:119/322 - (36%) Gaps:100/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 QKELLAMREKSRNTPLIRNIENEVSAAKTLEDNDGHDVENIYARNYVAAKVGQKKEDQLGTPEAV 435
            |.:..||:|.| ...|:..:.:..|            |:.:....|...::..|...::|:  .:
Zfish    31 QDQADAMQEHS-EPDLVEQLRSAGS------------VDELMRIVYPTYRIMLKCRSKMGS--RL 80

  Fly   436 IKARRLHAQKQKSERALAHAHMN-QVLK------EATCRIPQKRCQLVQQD---PSKIYTPHCTI 490
            ::......:.:..|.:.|.|.:| ::||      ..|..:|::.|..|.::   .:..|.|.|..
Zfish    81 LRREPSSTETRSEEASFAAAFINLELLKSIEIEWRKTLCMPRQVCLDVGKEFGATNTFYKPPCVS 145

  Fly   491 LHRCSEDSGCCPSRSQICAAKSTHNVELHFF-----VKSSKHRSVIEKRTFVNHTECHCI-ERST 549
            ::||   .|||.|....|...||..:....|     ||.......|   :|.|||.|.|: :::.
Zfish   146 VYRC---GGCCNSEELQCRNISTSYISKTLFEITVPVKQGTKPVTI---SFANHTSCSCLSKQNL 204

  Fly   550 YNEETAMAHYGQSVVRATILSC-----TCPKS------------------------FE------- 578
            |.::       .|::|..:..|     ||||:                        ||       
Zfish   205 YRQQ-------HSIIRRALTECHVANKTCPKNHSWSNHLCKCVLLPDTLHSKPHSDFETDFCGPD 262

  Fly   579 KILQDDGQCRCDCSSGNYDCDWLKR---GNEHFA-MNDRKCI---QQGRCKP------PTCE 627
            |.| |:..|:|:|...      |::   |..|:. .|..:|:   |...|.|      .||:
Zfish   263 KEL-DEETCQCECRKE------LRKAGCGPHHYLDKNTCQCVCKAQPSSCGPQQSFNRDTCQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 26/91 (29%)
vegfcNP_991297.1 PDGF 117..200 CDD:197537 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.