DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and Pvf1

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster


Alignment Length:205 Identity:43/205 - (20%)
Similarity:77/205 - (37%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 AQKQKSERALAHAHMNQVLKEATCRIPQKRCQLVQQDP------SKIYTPHCTILHRCSEDSGCC 501
            :.|:..:|::    |...::.||......:..:|:..|      :..|.|.||.:.||   :|||
  Fly   120 SSKENFKRSI----MKSTVRNATPASCSPQPTIVELKPPAEDEANYYYMPACTRISRC---NGCC 177

  Fly   502 PSRSQICAAKSTHNVELHFFVKSSKHRSVIEKRTFV-----NHTECHCIERSTYNEETAMAHYGQ 561
            .|....|.......|:|.  |:.....:...:|.|.     .||:|.|..|:...:         
  Fly   178 GSTLISCQPTEVEQVQLR--VRKVDRAATSGRRPFTIITVEQHTQCRCDCRTKAED--------- 231

  Fly   562 SVVRATILSCTCPKSFEKILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDR-KCIQQGRCK-PP 624
                     |...:|:.|.|     |||:|.:.:.....|::....:.::|. .|:    |: ..
  Fly   232 ---------CNVYQSYRKDL-----CRCECHNTDARDKCLEQAENKYWVDDNCTCV----CRYNQ 278

  Fly   625 TCEFGLYMDK 634
            :|..|...|:
  Fly   279 SCTTGTVFDE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 24/93 (26%)
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.