DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and VEGFD

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_004460.1 Gene:VEGFD / 2277 HGNCID:3708 Length:354 Species:Homo sapiens


Alignment Length:302 Identity:67/302 - (22%)
Similarity:109/302 - (36%) Gaps:82/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 MREKSRNTPLIRNIENEVSAAKTLEDNDGHDVENIYARNYVAAKVGQKKEDQLGTPEAVIK---A 438
            ::..|::|  :...|.::.||.:||:               ..::...::.:|......:|   :
Human    29 VKRSSQST--LERSEQQIRAASSLEE---------------LLRITHSEDWKLWRCRLRLKSFTS 76

  Fly   439 RRLHAQKQKSERALAHAHMNQVLK------EATCRIPQKRCQLVQQDPSK----IYTPHCTILHR 493
            ....:...:|.|..|..:..:.||      :.|...|::.|..|..:..|    .:.|.|..:.|
Human    77 MDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFR 141

  Fly   494 CSEDSGCCPSRSQICAAKSTHNVELHFFVKSSKHRSVIE--KRTFVNHTECHCIERSTYNEETAM 556
            |   .|||...|.||...||..:....|..|....||.|  .....|||.|.|:       .||.
Human   142 C---GGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCL-------PTAP 196

  Fly   557 AHYGQSVVRATIL-----SCT-----CPKSFEKILQDDGQCRC-----DCSSGNYDCDWLKRG-- 604
            .| ..|::|.:|.     .|:     ||..   :|.|..:|:|     :..:|..|...|:..  
Human   197 RH-PYSIIRRSIQIPEEDRCSHSKKLCPID---MLWDSNKCKCVLQEENPLAGTEDHSHLQEPAL 257

  Fly   605 -NEHFAMNDRKCIQQGRCKPPTCEFGLYMDKHGRCPK---QH 642
             ..|...::.:|  :..||.|             |||   ||
Human   258 CGPHMMFDEDRC--ECVCKTP-------------CPKDLIQH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 27/88 (31%)
VEGFDNP_004460.1 PDGF 109..193 CDD:197537 27/93 (29%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 222..318 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.