DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and Vegfa

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001020421.2 Gene:Vegfa / 22339 MGIID:103178 Length:392 Species:Mus musculus


Alignment Length:196 Identity:46/196 - (23%)
Similarity:78/196 - (39%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 KQKSERALAHAHMNQVLKEATCRIPQKRCQLVQQDPSK---IYTPHCTILHRCSEDSGCCPSRSQ 506
            :|||...:   ....|.:.:.||..:....:.|:.|.:   |:.|.|..|.||   :|||...:.
Mouse   211 EQKSHEVI---KFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRC---AGCCNDEAL 269

  Fly   507 ICAAKSTHNVELHFFVKSSKHRSV-IEKRTFVNHTECHCIERS--TYNEETAMAHYGQSVVRA-- 566
            .|...|..|:.:. .::...|:|. |.:.:|:.|:.|.|..:.  |..|:.::...|:...|.  
Mouse   270 ECVPTSESNITMQ-IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRK 333

  Fly   567 ----TILSCTCPKSFEK----ILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDRKCIQQGRCKP 623
                ...|..|....|:    .:||...|:|.|.:.:..|.     .....:|:|.|    ||..
Mouse   334 KSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCK-----ARQLELNERTC----RCDK 389

  Fly   624 P 624
            |
Mouse   390 P 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 23/86 (27%)
VegfaNP_001020421.2 PDGF 227..309 CDD:197537 23/85 (27%)
VEGF_C 343..392 CDD:291235 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.