Sequence 1: | NP_001097107.1 | Gene: | Pvf3 / 33995 | FlyBaseID: | FBgn0085407 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020421.2 | Gene: | Vegfa / 22339 | MGIID: | 103178 | Length: | 392 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 32/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 445 KQKSERALAHAHMNQVLKEATCRIPQKRCQLVQQDPSK---IYTPHCTILHRCSEDSGCCPSRSQ 506
Fly 507 ICAAKSTHNVELHFFVKSSKHRSV-IEKRTFVNHTECHCIERS--TYNEETAMAHYGQSVVRA-- 566
Fly 567 ----TILSCTCPKSFEK----ILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDRKCIQQGRCKP 623
Fly 624 P 624 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pvf3 | NP_001097107.1 | PDGF | 464..547 | CDD:238079 | 23/86 (27%) |
Vegfa | NP_001020421.2 | PDGF | 227..309 | CDD:197537 | 23/85 (27%) |
VEGF_C | 343..392 | CDD:291235 | 14/57 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1364454at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |