DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and Vegfd

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_034346.1 Gene:Vegfd / 14205 MGIID:108037 Length:358 Species:Mus musculus


Alignment Length:337 Identity:69/337 - (20%)
Similarity:106/337 - (31%) Gaps:99/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 EKSRNTPLIRNIENEVSAAKTLEDNDGHDVENIYARNYVAAKVGQKKEDQLGTPEAVIKARRLHA 443
            |:|..:.|.|: |.::.||.:||:               ..::...::.:|......:|:.....
Mouse    35 ERSSRSMLERS-EQQIRAASSLEE---------------LLQIAHSEDWKLWRCRLKLKSLASMD 83

  Fly   444 QKQKSERALAHA---HMNQVLK------EATCRIPQKRCQLVQQDPSK----IYTPHCTILHRCS 495
            .:..|.|:...|   :..:.||      :.|...|::.|..|..:..|    .:.|.|..:.|| 
Mouse    84 SRSASHRSTRFAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRC- 147

  Fly   496 EDSGCCPSRSQICAAKSTHNVELHFFVKSSKHRSVIE--KRTFVNHTECHC-----------IER 547
              .|||.....:|...||..:....|..|....||.|  .....|||.|.|           |.|
Mouse   148 --GGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR 210

  Fly   548 STYNEETAMAHYGQSVVRATIL----SCTCPKSFEKILQ--------------------DDGQCR 588
            |....|.....:.:.:....:|    .|.|....|..|.                    |:.:|.
Mouse   211 SIQTPEEDECPHSKKLCPIDMLWDNTKCKCVLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCE 275

  Fly   589 CDCSS----------GNYDCDWLKRGNE-----HFAMNDRKCIQQGRC---------KPPTCEFG 629
            |.|.:          .|..|...|...|     |...:...|..:.||         :.|.|   
Mouse   276 CVCKAPCPGDLIQHPENCSCFECKESLESCCQKHKIFHPDTCSCEDRCPFHTRTCASRKPAC--- 337

  Fly   630 LYMDKHGRCPKQ 641
               .||.|.||:
Mouse   338 ---GKHWRFPKE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 26/99 (26%)
VegfdNP_034346.1 PDGF 114..198 CDD:197537 25/86 (29%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 227..323 15/95 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.