DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfbb

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_003200919.3 Gene:vegfbb / 100535766 ZFINID:ZDB-GENE-091204-285 Length:152 Species:Danio rerio


Alignment Length:103 Identity:31/103 - (30%)
Similarity:49/103 - (47%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 HAHMNQVLK---EATCRIPQKRCQLVQQDPSKI----YTPHCTILHRCSEDSGCCPSRSQIC--A 509
            |.| :||:|   ...|: |::....|:.:.|::    ..|.|..|.||   .|||...:.:|  .
Zfish    52 HPH-HQVVKLYMSTLCK-PRETLVKVEDEFSEVMLGHVVPSCVPLQRC---GGCCSDEAMVCVNV 111

  Fly   510 AKSTHNVELHFFVKSSK---HRSVIEKRTFVNHTECHC 544
            ||.|..::|..:...|:   ..|:|| ..||.|::|.|
Zfish   112 AKHTTIIQLQQYATDSEGNMAESIIE-LPFVEHSQCQC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 26/90 (29%)
vegfbbXP_003200919.3 PDGF 66..148 CDD:278756 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.