DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and pdgfb

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001297028.1 Gene:pdgfb / 100492827 XenbaseID:XB-GENE-487583 Length:240 Species:Xenopus tropicalis


Alignment Length:117 Identity:25/117 - (21%)
Similarity:46/117 - (39%) Gaps:16/117 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 LHAQKQKSERALAHAHM-------NQVLKEATCRIPQKRCQLVQQDPSK---IYTPHCTILHRCS 495
            :|..:.....:.:|:.:       ..|:.|...|:..........||:.   :..|.|..:.|| 
 Frog    62 IHQTRSSPTNSSSHSRVIRSLDAEKAVIAECKPRVEVFEISRKIVDPTNANFLVWPPCVEVQRC- 125

  Fly   496 EDSGCCPSRSQICAAKSTH--NVELH-FFVKSSKHRSVIEKRTFVNHTECHC 544
              ||||.|::..||....|  :|::: .|:.....:.|.......:|.:|.|
 Frog   126 --SGCCNSKNMRCAPTRIHVRHVQVNKIFITPKGKKQVKVVVPLEDHHDCKC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 21/87 (24%)
pdgfbNP_001297028.1 PDGF_N 19..90 CDD:368059 3/27 (11%)
PDGF 92..175 CDD:366040 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.