DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfc

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_002933363.1 Gene:vegfc / 100487606 XenbaseID:XB-GENE-484533 Length:407 Species:Xenopus tropicalis


Alignment Length:325 Identity:63/325 - (19%)
Similarity:99/325 - (30%) Gaps:138/325 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 ALAHAHMNQVL--------KEATCRIPQKRCQLVQQD----PSKIYTPHCTILHRCSEDSGCCPS 503
            |.||.:.|..:        ::..| ||::.|..|.::    .:..:.|.|..::||   .|||.|
 Frog    94 AAAHYNYNAEIWKSIENEWRKTQC-IPREVCVDVGKEFGAPTNTFFKPPCVSVYRC---GGCCNS 154

  Fly   504 RSQICA-AKSTHNVELHFFVKSSKHRSVIEKRT--FVNHTECHCIER-STYNEETAMAHYGQSVV 564
            ....|. ..||...:..|.:.....:..::..|  |.|||.|.|:.: ..|.:    .|   |::
 Frog   155 EGLHCMNTSSTFVSKTLFEITVPLSQGPVKPVTISFANHTSCRCMSKLDVYRQ----VH---SII 212

  Fly   565 R----ATILSC-----TCPKSF-------EKILQ----------------------------DDG 585
            |    ||.|.|     |||::.       ..|:|                            |:.
 Frog   213 RRSLPATQLQCQVANKTCPRNHIWNNHVCRCIMQHDVEFSPSPEEEDNEEAFNDICGPNKELDEE 277

  Fly   586 QCRCDCSSG----------------------------------NYD-----CDWLKRGNEHFAMN 611
            .|:|.|..|                                  .||     |...:...::..:|
 Frog   278 TCQCVCKGGLVPSSCGPQKELDRTSCKCVCKNKLLASSCGPNKQYDEEKCQCVCKRSCPKNLPLN 342

  Fly   612 DRKCI-----QQGRC---------------------KPPTCEFGLYMDKH-GRC-PKQHEQPSYN 648
            ..||.     ...:|                     :|..||.|.|..:. .|| |...::|..|
 Frog   343 SAKCACECTESPNKCFLKGKKFHHPTCSCYRPPCTTRPKRCEHGFYYSEEVCRCVPTYWKRPHMN 407

  Fly   649  648
             Frog   408  407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 24/89 (27%)
vegfcXP_002933363.1 PDGF 115..200 CDD:197537 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.