DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfb

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_031756507.1 Gene:vegfb / 100487116 XenbaseID:XB-GENE-483494 Length:278 Species:Xenopus tropicalis


Alignment Length:267 Identity:49/267 - (18%)
Similarity:92/267 - (34%) Gaps:74/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 SAAKTLEDNDGHDVENIYARNYVAAKVGQ----KKEDQLGTPEAVIKARR---LHAQKQKSERAL 452
            |:.|..:.:..|..|        :.:||:    .::..|.:.|.|.|.::   |:.:|....:.|
 Frog    48 SSLKKKKTSGPHSPE--------SRRVGEDSFASQQGPLTSIEDVHKIQKINILYRRKHFQTKGL 104

  Fly   453 AHAHMNQVLKEATCRIPQKRCQLVQQDP---SKIYTPHCTILHRCSEDSGCCPSRSQICAAKSTH 514
            :..   .:...:.|:.......|:.:.|   ..::.|.|..:.||   :|||...:..|....|:
 Frog   105 SWV---DIYNRSQCQPRWILLNLLSEFPHYSDFLFIPPCVSVLRC---AGCCLDEALGCTPLQTN 163

  Fly   515 NVELHFFVKSSKHRSVIEKRTFVNHTECHCIERSTYNEETAMAH------------------YGQ 561
            |:.:. .:|:...:|.:...:...|..|.|..::|..   ..||                  .|.
 Frog   164 NITMQ-VIKTKSLQSDLTNLSITQHVSCQCRPKNTVR---LKAHSIYISGEKKVKKRRRKGKNGN 224

  Fly   562 SVVRATILSCTCPKSFEKILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDRKCIQQG------R 620
            ...:|.  ...||...:....:...|.|.|:                 :.:.||:.||      |
 Frog   225 GTPQAD--GSPCPPCNKHSTLNPITCECICN-----------------ITEEKCLLQGRQFHKER 270

  Fly   621 CKPPTCE 627
            |:   ||
 Frog   271 CR---CE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 18/85 (21%)
vegfbXP_031756507.1 PDGF 113..194 CDD:412171 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.