DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf3 and vegfd

DIOPT Version :9

Sequence 1:NP_001097107.1 Gene:Pvf3 / 33995 FlyBaseID:FBgn0085407 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_002942609.3 Gene:vegfd / 100144690 XenbaseID:XB-GENE-487325 Length:333 Species:Xenopus tropicalis


Alignment Length:372 Identity:70/372 - (18%)
Similarity:111/372 - (29%) Gaps:131/372 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 EGFSNEQWNKIEHQHHLRQQKHQKELLAMREKSRNTPLIRNIENEVSAAKTLEDNDGHDVENIYA 413
            :||.||.                     |:..|:.     .:|.::.:|..||:    .:...:.
 Frog    19 QGFDNEN---------------------MKGASQT-----ELEQKIRSAANLEE----FLRITHP 53

  Fly   414 RNYVAAKVGQKKEDQLGTPEAVIKARRLHAQKQKSERALAHAHMNQVLK------EATCRIPQKR 472
            |.....:...|.:..:|:..        .:...:|.|..|..:..::||      :.|..||::.
 Frog    54 RELKLWRCRSKLKSYIGSDS--------RSASHRSTRFAAAFYDIEILKVIDEEWQKTQCIPRET 110

  Fly   473 CQLVQQD----PSKIYTPHCTILHRCSEDSGCCPSRSQICAAKSTHNVELHFFVKSSKHRSVIEK 533
            |..|.:|    .:..:.|.|..:.||   .|||......|...||..:....|..|.......|.
 Frog   111 CVDVGKDLGTSTNTFFKPPCVSVFRC---GGCCNEEGISCVNTSTSYIFKTLFEISVPLTQAPEP 172

  Fly   534 RT--FVNHTECHC-----------IERST-------YNEETAMAHYGQ----------------S 562
            .|  ..|||.|.|           |.||.       |.|:|:..:..|                :
 Frog   173 VTIKIANHTSCKCTPSSPRLSKAIIRRSVHYPEYGCYQEDTSCQNGWQWDSNLCVCVPQREPTIN 237

  Fly   563 VVRATILSCTCPKSFEKILQDDGQCRCDCSSGNYDCDWLKRGNEHFAMNDRKCIQQGRCK----- 622
            ..|..:..|.....||      ..|.|.|..        |..:.|..:|...|:.:  ||     
 Frog   238 RRREELAICGAHMEFE------DNCECVCKR--------KCPSIHHVLNQESCLCE--CKETLES 286

  Fly   623 ---------------PPTCEFGL--------YMDKHGRCPKQHEQPS 646
                           ..||.|.:        ...|:.:||::....|
 Frog   287 CYKKQKIFFPDTCSCEDTCPFQIKECPNGKQVCAKYFQCPRERRGTS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf3NP_001097107.1 PDGF 464..547 CDD:238079 26/99 (26%)
vegfdXP_002942609.3 PDGF 103..187 CDD:197537 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.