DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and si:ch211-79m20.1

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_009294732.1 Gene:si:ch211-79m20.1 / 798657 ZFINID:ZDB-GENE-081031-37 Length:463 Species:Danio rerio


Alignment Length:224 Identity:56/224 - (25%)
Similarity:90/224 - (40%) Gaps:41/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 QGDDNHLSSDAAVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMKYNNNRTRELKKRVEAHRL 196
            |||.   ...:.||...:.|.....||..|.:..:.:...||..|..::|...:.|.:.:.   :
Zfish    24 QGDP---LPPSLVDLVMNSPISTVDDLKKLLDVESVEEDDEKPETEMHSNGTHKRLPRSLS---I 82

  Fly   197 MMAKEGICRVPRPEVVHIT------RETNTFYSPRATILHRCSDKVGCCNA-GWTCQMKRNETVD 254
            .:|::.:|:| |.||:.:|      |..|....|....:.|||   ||||| ...|.....||..
Zfish    83 QVAQQAMCKV-RTEVMEVTRAMFDRRNANFMLWPSCVEVQRCS---GCCNARTLQCVPVITETRH 143

  Fly   255 RVFDKVDGRSNEP----IVISMENHTECGC-VKVETRRKR------SPICLCPK----------- 297
            ....|:...:.:|    :||.:|:|..|.| ::|..:..|      .|..|.||           
Zfish   144 LQITKIQYINRQPSYEKVVIPVEDHVTCSCQLRVPAQPPRVQTTPLPPPRLLPKVTPPKTQSKEE 208

  Fly   298 -HFKDFSWAGSRAQWENEEHLELRLWERR 325
             |..|......:...|::|..||: |:.:
Zfish   209 LHRNDELKHNQQLHLEDKESQELQ-WQSK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 27/86 (31%)
si:ch211-79m20.1XP_009294732.1 PDGF_N 24..89 CDD:309710 15/70 (21%)
PDGF 90..173 CDD:306779 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.