DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and pdgfab

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001070225.1 Gene:pdgfab / 767790 ZFINID:ZDB-GENE-060929-124 Length:230 Species:Danio rerio


Alignment Length:184 Identity:42/184 - (22%)
Similarity:71/184 - (38%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DQPGDLTVLKERIAEQNSVEKLRTMKYNNNRTRELKKRVEAHR-----LMMAKEGICR------- 205
            :.||....:.|.:.:::..:...:.|   :...:||.|..:||     :..|...:|:       
Zfish    52 NSPGPGNEVTEEVKQKHHQKSQHSYK---SFASDLKSRQLSHRRKRSIVEEAVPAMCKTRTVIYE 113

  Fly   206 VPRPEVVHITRETNTFYSPRATILHRCSDKVGCCNAG-WTC--QMKRNETVDRVFDKVDGRSN-- 265
            :||.:|  .....|....|....:.||:   ||||.| ..|  ..|::.||.  ..||:..|.  
Zfish   114 IPRSQV--DPTAANFLIWPPCVEVKRCT---GCCNTGNMRCHPSKKQHRTVK--VAKVEFASRKK 171

  Fly   266 ---EPIVISMENHTECGCVK----------------VETRRKRSPICLCPKHFK 300
               :.:::.:|:|.||.|..                |:.|:||       ||.|
Zfish   172 AKLKEVLVRLEDHLECICTSQHHVIEHVEADTGPRTVKNRKKR-------KHRK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 24/90 (27%)
pdgfabNP_001070225.1 PDGF_N 22..104 CDD:368059 10/54 (19%)
PDGF 105..189 CDD:366040 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.