DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and VEGFA

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001020537.2 Gene:VEGFA / 7422 HGNCID:12680 Length:412 Species:Homo sapiens


Alignment Length:201 Identity:41/201 - (20%)
Similarity:62/201 - (30%) Gaps:72/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ETNTFYSPRATILHRCSDKVGCCN-AGWTCQMKRNETVDRVFDKVDGRSNEPI-VISMENHTECG 279
            |....:.|....|.||.   |||| .|..|.......:.....::.....:.| .:|...|.:|.
Human   248 EIEYIFKPSCVPLMRCG---GCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCE 309

  Fly   280 CVKVETR----------------RKRSPICLCPKHFKDFS-WAGSRA---QW------------E 312
            |...:.|                |||.     ...:|.:| :.|:|.   .|            |
Human   310 CRPKKDRARQEKKSVRGKGKGQKRKRK-----KSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSE 369

  Fly   313 NEEHLELRLWERREQRCRCDCHLSDETCKRLKNGVEGFSVMERRRIQSGEVSPPFCNYGAYDVRN 377
            ..:|    |:.:..|.|:|.|..:|..||             .|:::..|             |.
Human   370 RRKH----LFVQDPQTCKCSCKNTDSRCK-------------ARQLELNE-------------RT 404

  Fly   378 GRCPRP 383
            .||.:|
Human   405 CRCDKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 15/64 (23%)
VEGFANP_001020537.2 PDGF 230..312 CDD:197537 16/66 (24%)
VEGF_C 364..412 CDD:291235 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.