Sequence 1: | NP_523499.2 | Gene: | Pvf2 / 33994 | FlyBaseID: | FBgn0031888 | Length: | 405 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020537.2 | Gene: | VEGFA / 7422 | HGNCID: | 12680 | Length: | 412 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 62/201 - (30%) | Gaps: | 72/201 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 ETNTFYSPRATILHRCSDKVGCCN-AGWTCQMKRNETVDRVFDKVDGRSNEPI-VISMENHTECG 279
Fly 280 CVKVETR----------------RKRSPICLCPKHFKDFS-WAGSRA---QW------------E 312
Fly 313 NEEHLELRLWERREQRCRCDCHLSDETCKRLKNGVEGFSVMERRRIQSGEVSPPFCNYGAYDVRN 377
Fly 378 GRCPRP 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pvf2 | NP_523499.2 | PDGF | 204..280 | CDD:294083 | 15/64 (23%) |
VEGFA | NP_001020537.2 | PDGF | 230..312 | CDD:197537 | 16/66 (24%) |
VEGF_C | 364..412 | CDD:291235 | 16/77 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1364454at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |