DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and Pvf1

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster


Alignment Length:306 Identity:74/306 - (24%)
Similarity:114/306 - (37%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IRLIRRRVPRDQAPQQVILQGRSLSGVHWGQGDDNHLSSDAAVDGSD---DYPSDQPGDLTVLKE 163
            :||:|:......||.  .|:|....|.....|....|....:.:.::   ||  |..|::...||
  Fly    63 VRLLRQADDPSAAPG--ALEGSCCQGAAAEAGTPLTLPLSVSAELTNVTADY--DVSGEMPSSKE 123

  Fly   164 RIAEQNSVEKLRTMKYNNNRTRELKKRVEAHRLMMAKEGICRVPRPEVVHI----TRETNTFYSP 224
                                  ..|:.:....:..|....|. |:|.:|.:    ..|.|.:|.|
  Fly   124 ----------------------NFKRSIMKSTVRNATPASCS-PQPTIVELKPPAEDEANYYYMP 165

  Fly   225 RATILHRCSDKVGCCNAGW-TCQMKRNETVDRVFDKVD-----GRSNEPI-VISMENHTECGC-- 280
            ..|.:.||:   |||.:.. :||....|.|.....|||     ||  .|. :|::|.||:|.|  
  Fly   166 ACTRISRCN---GCCGSTLISCQPTEVEQVQLRVRKVDRAATSGR--RPFTIITVEQHTQCRCDC 225

  Fly   281 -VKVET----RRKRSPICLCPKHFKDFSWAGSRAQWENEEHLELRLWERREQRCRCDCHLS---- 336
             .|.|.    :..|..:|.|..|..|       |:.:..|..|.:.|.  :..|.|.|..:    
  Fly   226 RTKAEDCNVYQSYRKDLCRCECHNTD-------ARDKCLEQAENKYWV--DDNCTCVCRYNQSCT 281

  Fly   337 -----DETCKRLKNGVEGFSVMERRR--IQSGEVSPPFCNYGAYDV 375
                 |||..:..:......|::|:|  :|:.:|.|.  |...|.|
  Fly   282 TGTVFDETQCKCTDPAAPIDVLDRKRFIVQAVQVDPD--NTTLYSV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 29/86 (34%)
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.