DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and vegfaa

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_009290293.1 Gene:vegfaa / 30682 ZFINID:ZDB-GENE-990415-273 Length:207 Species:Danio rerio


Alignment Length:147 Identity:37/147 - (25%)
Similarity:58/147 - (39%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KEGICRVPRPEVVHITR----ETNTFYSPRATILHRCSDKVGCCN-AGWTC--QMKRNETVD--R 255
            |:..|:. |..:|.|.:    |....|.|...:|.||:   |||| ....|  ...||.|::  |
Zfish    45 KKSACKT-RELLVDIIQEYPDEIEHTYIPSCVVLMRCA---GCCNDEALECVPTETRNVTMEVLR 105

  Fly   256 VFDKVDGRSNEPIVISMENHTECGC---VKVETRRKRSP---ICLCPKHFKDFSWAGSRAQWENE 314
            |..:|   |.....:|...||:|.|   .:|:.::::.|   ....|...::....|..|.....
Zfish   106 VKQRV---SQHNFQLSFTEHTKCECRPKAEVKAKKEKKPRVRRVKNPNRAREGDSGGLSASAHLR 167

  Fly   315 EHLELRLWERREQRCRC 331
            ....:.|.:|....|.|
Zfish   168 SSTTVSLAQREGSACMC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 26/84 (31%)
vegfaaXP_009290293.1 PDGF 49..127 CDD:278756 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.