DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and VEGFD

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_004460.1 Gene:VEGFD / 2277 HGNCID:3708 Length:354 Species:Homo sapiens


Alignment Length:339 Identity:72/339 - (21%)
Similarity:117/339 - (34%) Gaps:121/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 QGDDNH-----LSSDAAVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMKYNNN------RTR 185
            ||..|.     .||.:.::.|:              ::|...:|:|:|..:.::.:      |.|
Human    20 QGSSNEHGPVKRSSQSTLERSE--------------QQIRAASSLEELLRITHSEDWKLWRCRLR 70

  Fly   186 -----ELKKRVEAHR-------------LMMAKEGICRV---PRPEVVHITRE----TNTFYSPR 225
                 .:..|..:||             |.:..|...|.   ||...|.:..|    ||||:.|.
Human    71 LKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPP 135

  Fly   226 ATILHRCSDKVGCCN-AGWTCQMKRNETVDR-VFDKVDGRSNEP--IVISMENHTECGCVKVETR 286
            ...:.||.   |||| ....|.......:.: :|:.....::.|  :.:.:.|||.|.|:....|
Human   136 CVNVFRCG---GCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPR 197

  Fly   287 RKRSPI-----------C-----LCPKHFKDFSWAGSRA----QWEN-----EEHLELR------ 320
            ...|.|           |     |||   .|..|..::.    |.||     |:|..|:      
Human   198 HPYSIIRRSIQIPEEDRCSHSKKLCP---IDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCG 259

  Fly   321 ---LWERREQRCRCDC----------HLSDETCKRLKNGVEGFSVMERRRIQSGEVSPPFCNYGA 372
               :::  |.||.|.|          |..:.:|...|..:|  :..::.::    ..|..|:.  
Human   260 PHMMFD--EDRCECVCKTPCPKDLIQHPKNCSCFECKESLE--TCCQKHKL----FHPDTCSC-- 314

  Fly   373 YDVRNGRCP---RP 383
                ..|||   ||
Human   315 ----EDRCPFHTRP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 23/86 (27%)
VEGFDNP_004460.1 PDGF 109..193 CDD:197537 23/86 (27%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 222..318 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.