DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and Vegfc

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_033532.1 Gene:Vegfc / 22341 MGIID:109124 Length:415 Species:Mus musculus


Alignment Length:343 Identity:72/343 - (20%)
Similarity:118/343 - (34%) Gaps:141/343 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 AVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMKYN--------------------NNRTREL 187
            |.:|.|            |:|::...:||::|.::.|.                    |.||.:.
Mouse    50 AFEGKD------------LEEQLRSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDS 102

  Fly   188 KKRVEAH---RLMMAKEGICR----VPRPEVVHITRE----TNTFYSPRATILHRCSDKVGCCNA 241
            .|...||   .::.:.:...|    :||...:.:.:|    ||||:.|....::||.   ||||:
Mouse   103 VKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCG---GCCNS 164

  Fly   242 -GWTCQMKRNETVDRVFDKVD---GRSNEPIVISMENHTECGCV-KVETRR------KRS----- 290
             |..|.......:.:...::.   .:..:|:.||..|||.|.|: |::..|      :||     
Mouse   165 EGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATL 229

  Fly   291 PIC-----LCPKHFKDFSWAGSRAQWENEEHLELRLWERREQRCRC------------------- 331
            |.|     .||.::          .|.|             ..|||                   
Mouse   230 PQCQAANKTCPTNY----------VWNN-------------YMCRCLAQQDFIFYSNVEDDSTNG 271

  Fly   332 -------DCHLSDETCKRL-KNGVEGFSV-----MERRRIQ---SGEVSPPFCNYGA---YD--- 374
                   :..|.::||:.: |.|:...|.     ::|...|   ..::.|..|  ||   :|   
Mouse   272 FHDVCGPNKELDEDTCQCVCKGGLRPSSCGPHKELDRDSCQCVCKNKLFPNSC--GANREFDENT 334

  Fly   375 ---VRNGRCPR-----PG 384
               |....|||     ||
Mouse   335 CQCVCKRTCPRNQPLNPG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 24/87 (28%)
VegfcNP_033532.1 PDGF 127..207 CDD:278756 23/82 (28%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 276..358 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.