DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and Vegfa

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001020421.2 Gene:Vegfa / 22339 MGIID:103178 Length:392 Species:Mus musculus


Alignment Length:281 Identity:55/281 - (19%)
Similarity:87/281 - (30%) Gaps:95/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LSGVHWGQGDDNHLS----SDAAVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMK-YNNNRT 184
            ||.|||......:|.    |.||       |:.:           .||.|.|.::.|. |..:..
Mouse   183 LSWVHWTLALLLYLHHAKWSQAA-------PTTE-----------GEQKSHEVIKFMDVYQRSYC 229

  Fly   185 RELKKRVEAHRLMMAKEGICRVPRPEVVHITRETNTFYSPRATILHRCSDKVGCCN-AGWTCQMK 248
            |.::..|:..:           ..|:      |....:.|....|.||:   |||| ....|...
Mouse   230 RPIETLVDIFQ-----------EYPD------EIEYIFKPSCVPLMRCA---GCCNDEALECVPT 274

  Fly   249 RNETVDRVFDKVDGRSNEPI-VISMENHTECGCVKVETRRKRSPICLCPKHFKDFSWAGSRAQWE 312
            ....:.....::....::.| .:|...|:.|.|...:.|.|.....:..|         .:.|..
Mouse   275 SESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGK---------GKGQKR 330

  Fly   313 NEEHLELRLW--------ERRE-------QRCRCDCHLSDETCKRLKNGVEGFSVMERRRIQSGE 362
            ..:....:.|        |||:       |.|:|.|..:|..||             .|:::..|
Mouse   331 KRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCK-------------ARQLELNE 382

  Fly   363 VSPPFCNYGAYDVRNGRCPRP 383
                         |..||.:|
Mouse   383 -------------RTCRCDKP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 15/77 (19%)
VegfaNP_001020421.2 PDGF 227..309 CDD:197537 18/101 (18%)
VEGF_C 343..392 CDD:291235 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.