DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and Vegfd

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_034346.1 Gene:Vegfd / 14205 MGIID:108037 Length:358 Species:Mus musculus


Alignment Length:297 Identity:63/297 - (21%)
Similarity:101/297 - (34%) Gaps:95/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KERIAEQNSVEKLRTMKYNNN----RTR-------ELKKRVEAHR-------------LMMAKEG 202
            :::|...:|:|:|..:.::.:    |.|       .:..|..:||             |.:..|.
Mouse    46 EQQIRAASSLEELLQIAHSEDWKLWRCRLKLKSLASMDSRSASHRSTRFAATFYDTETLKVIDEE 110

  Fly   203 ICRV---PRPEVVHITRE----TNTFYSPRATILHRCSDKVGCCN-AGWTCQMKRNETVDR-VFD 258
            ..|.   ||...|.:..|    ||||:.|....:.||.   |||| .|..|.......:.: :|:
Mouse   111 WQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCG---GCCNEEGVMCMNTSTSYISKQLFE 172

  Fly   259 KVDGRSNEP--IVISMENHTECGCVKVETRRKRSPI-----------C-----LCPKHFKDFSWA 305
            .....::.|  :.:.:.|||.|.|:....|...|.|           |     |||   .|..|.
Mouse   173 ISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCP---IDMLWD 234

  Fly   306 GSRAQWENEEHLELRLWERR----------------EQRCRCDC----------HLSDETCKRLK 344
            .::.:...::...|...|..                |.||.|.|          |..:.:|...|
Mouse   235 NTKCKCVLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGDLIQHPENCSCFECK 299

  Fly   345 NGVEGFSVMERRRIQSGEVSPPFCNYGAYDVRNGRCP 381
            ..:|  |..::.:|    ..|..|:.      ..|||
Mouse   300 ESLE--SCCQKHKI----FHPDTCSC------EDRCP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 24/86 (28%)
VegfdNP_034346.1 PDGF 114..198 CDD:197537 24/86 (28%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 227..323 19/110 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.