DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and vegfba

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_005157219.2 Gene:vegfba / 101885552 ZFINID:ZDB-GENE-120510-3 Length:246 Species:Danio rerio


Alignment Length:176 Identity:37/176 - (21%)
Similarity:53/176 - (30%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PRPEVVHITR----ETNTFYSPRATILHRCSDKVGCC-NAGWTCQMKRNETVDRVFDKVDGRSNE 266
            ||..:|.:.:    |||..:.|....|.||.   ||| :....|...:..|:.....|.....:|
Zfish    57 PRETLVEVWQEFPWETNHLFLPSCVTLRRCG---GCCSDEALECVPSQTHTLVMELMKTSYMKHE 118

  Fly   267 PIVISMENHTECGC-VKVE------------TRRKRSPICLCPKHFKDF---------------- 302
            .:.:....|.:|.| :|..            |||.|......||..|..                
Zfish   119 LVQLPFIEHNQCECRLKANLYAEPTRQGPQTTRRGRKRQRGKPKRKKHMGKNSMMLVPTTPPPPP 183

  Fly   303 ------SWAGSRAQWENEEHLELRLWERREQRCRCDCHLSDETCKR 342
                  |.|......|......:|........|.|.|.|.:.:|.:
Zfish   184 PPTLPPSSAPPTPAREACPPCPIRKMTSHPPSCECRCSLREVSCTK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 19/77 (25%)
vegfbaXP_005157219.2 PDGF 55..132 CDD:306779 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.