DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and pdgfb

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001297028.1 Gene:pdgfb / 100492827 XenbaseID:XB-GENE-487583 Length:240 Species:Xenopus tropicalis


Alignment Length:172 Identity:39/172 - (22%)
Similarity:70/172 - (40%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 AVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMKYNNNRTRELKKRVEAHRLMMAKEGICRVP 207
            :||..||                ....|:.:.|:...|::....:.:.::|.:.::|:   |: |
 Frog    50 SVDDEDD----------------LNYASIHQTRSSPTNSSSHSRVIRSLDAEKAVIAE---CK-P 94

  Fly   208 RPEVVHITRE------TNTFYSPRATILHRCSDKVGCCNA-GWTCQMK----RNETVDRVFDKVD 261
            |.||..|:|:      .|....|....:.|||   ||||: ...|...    |:..|:::|....
 Frog    95 RVEVFEISRKIVDPTNANFLVWPPCVEVQRCS---GCCNSKNMRCAPTRIHVRHVQVNKIFITPK 156

  Fly   262 GRSNEPIVISMENHTECGCVKV------------ETRRKRSP 291
            |:....:|:.:|:|.:|.|..|            ||::...|
 Frog   157 GKKQVKVVVPLEDHHDCKCEPVPSSAVRIHHPPPETKKAEPP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 25/86 (29%)
pdgfbNP_001297028.1 PDGF_N 19..90 CDD:368059 8/55 (15%)
PDGF 92..175 CDD:366040 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.