DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and vegfc

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_002933363.1 Gene:vegfc / 100487606 XenbaseID:XB-GENE-484533 Length:407 Species:Xenopus tropicalis


Alignment Length:290 Identity:64/290 - (22%)
Similarity:104/290 - (35%) Gaps:108/290 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 WGQGDDNHLSSDAAVDGSDDY--------PSDQPGDLTVLKERIAEQNSVEKLRTMKY------- 179
            |.|       ..||.:....|        ..||||  ..|:|::...:||::|.|:.|       
 Frog    16 WAQ-------RGAAYESGQGYYDDPEFGDTKDQPG--RELEEQLRSVSSVDELMTLLYPESWKMF 71

  Fly   180 -------------------------NNNRTRELKKRVEAHRLMMAKEGICRVPRPEVVHITRE-- 217
                                     :.|...|:.|.:|..    .::..| :||...|.:.:|  
 Frog    72 KCQLRQGGSTGYDTRREDSFTFAAAHYNYNAEIWKSIENE----WRKTQC-IPREVCVDVGKEFG 131

  Fly   218 --TNTFYSPRATILHRCSDKVGCCNA-GWTCQMKRNETVDRVFDKVDGRSNE----PIVISMENH 275
              ||||:.|....::||.   ||||: |..|....:..|.:...::....::    |:.||..||
 Frog   132 APTNTFFKPPCVSVYRCG---GCCNSEGLHCMNTSSTFVSKTLFEITVPLSQGPVKPVTISFANH 193

  Fly   276 TECGCV-KVETRRKRSPI-----------C-----LCPKHF------------KDFSWAGSRAQW 311
            |.|.|: |::..|:...|           |     .||::.            .|..::.|..:.
 Frog   194 TSCRCMSKLDVYRQVHSIIRRSLPATQLQCQVANKTCPRNHIWNNHVCRCIMQHDVEFSPSPEEE 258

  Fly   312 ENEE--------HLELRLWERREQRCRCDC 333
            :|||        :.||     .|:.|:|.|
 Frog   259 DNEEAFNDICGPNKEL-----DEETCQCVC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 26/84 (31%)
vegfcXP_002933363.1 PDGF 115..200 CDD:197537 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.