DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and vegfb

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_031756507.1 Gene:vegfb / 100487116 XenbaseID:XB-GENE-483494 Length:278 Species:Xenopus tropicalis


Alignment Length:259 Identity:49/259 - (18%)
Similarity:89/259 - (34%) Gaps:87/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LQGRSLSGVHWGQGDDNHLSSDAAVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTM-KYNNNR 183
            |:.:..||.|         |.::...|.|.:.|.| |.||    .|.:.:.::|:..: :..:.:
 Frog    50 LKKKKTSGPH---------SPESRRVGEDSFASQQ-GPLT----SIEDVHKIQKINILYRRKHFQ 100

  Fly   184 TRELKKRVEAHRLMMAKEGICRVPRPEVVHITRE----TNTFYSPRATILHRCSDKVGCC---NA 241
            |:.| ..|:.:.....:      ||..::::..|    ::..:.|....:.||:   |||   ..
 Frog   101 TKGL-SWVDIYNRSQCQ------PRWILLNLLSEFPHYSDFLFIPPCVSVLRCA---GCCLDEAL 155

  Fly   242 GWTCQMKRNETVDRVFDKVDGRSNEPIVISMENHTECGC------------------VKVETRRK 288
            |.|.....|.|:..:  |.....::...:|:..|..|.|                  .||:.||:
 Frog   156 GCTPLQTNNITMQVI--KTKSLQSDLTNLSITQHVSCQCRPKNTVRLKAHSIYISGEKKVKKRRR 218

  Fly   289 R------------SPICLCPKHFKDFSWAGSRAQWENEEHLELRLWERREQRCRCDCHLSDETC 340
            :            ||...|.||.                       ......|.|.|::::|.|
 Frog   219 KGKNGNGTPQADGSPCPPCNKHS-----------------------TLNPITCECICNITEEKC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 17/82 (21%)
vegfbXP_031756507.1 PDGF 113..194 CDD:412171 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.