DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf2 and vegfd

DIOPT Version :9

Sequence 1:NP_523499.2 Gene:Pvf2 / 33994 FlyBaseID:FBgn0031888 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_002942609.3 Gene:vegfd / 100144690 XenbaseID:XB-GENE-487325 Length:333 Species:Xenopus tropicalis


Alignment Length:275 Identity:59/275 - (21%)
Similarity:97/275 - (35%) Gaps:87/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 VHWGQGDDNHLSSDAAVDGSDDYPSDQPGDLTVLKERIAEQNSVEKLRTMKYNNNRTRELK---- 188
            :|..||.||.....|:              .|.|:::|....::|:...:.:    .||||    
 Frog    15 LHLLQGFDNENMKGAS--------------QTELEQKIRSAANLEEFLRITH----PRELKLWRC 61

  Fly   189 -----------KRVEAHR-------------LMMAKEGICR---VPRPEVVHITRE----TNTFY 222
                       .|..:||             |.:..|...:   :||...|.:.::    ||||:
 Frog    62 RSKLKSYIGSDSRSASHRSTRFAAAFYDIEILKVIDEEWQKTQCIPRETCVDVGKDLGTSTNTFF 126

  Fly   223 SPRATILHRCSDKVGCCN-AGWTCQMKRNETVDRVFDKVD---GRSNEPIVISMENHTECGCVKV 283
            .|....:.||.   |||| .|.:|.......:.:...::.   .::.||:.|.:.|||.|.|...
 Frog   127 KPPCVSVFRCG---GCCNEEGISCVNTSTSYIFKTLFEISVPLTQAPEPVTIKIANHTSCKCTPS 188

  Fly   284 ETRRKRSPICLCPKHFKDF-----------SWAGSRAQWENE-----EHLELRLWERREQRCRCD 332
            ..|..:: |.....|:.::           .|     ||::.     ...|..:..|||:...|.
 Frog   189 SPRLSKA-IIRRSVHYPEYGCYQEDTSCQNGW-----QWDSNLCVCVPQREPTINRRREELAICG 247

  Fly   333 CHLSDE-----TCKR 342
            .|:..|     .|||
 Frog   248 AHMEFEDNCECVCKR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf2NP_523499.2 PDGF 204..280 CDD:294083 23/86 (27%)
vegfdXP_002942609.3 PDGF 103..187 CDD:197537 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.