DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and NOP13

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_014224.2 Gene:NOP13 / 855547 SGDID:S000005119 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:69/287 - (24%)
Similarity:117/287 - (40%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 ERKRSHSRSRDRNSRRRGTNSPRRRSPPNGADRTTPTELSPEERDARTVFCIQLSQRVRARDLEE 255
            |:|:|.:..:|........|:      |.|.:.....:...::.:...|:...||......||..
Yeast    85 EKKKSGASEKDAQGEESTINT------PTGDESGEVVKKKKKDENKYGVWIGNLSFDTTKDDLVR 143

  Fly   256 FFSSVGKVRD--------------------VRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQ 300
            ||  :.|.:|                    |.....|..|. ||..|:.|.:.|.:...|.||..
Yeast   144 FF--IAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKN-KGFCYMFFKNVEQMKAVLELSES 205

  Fly   301 RLLGVPIMVQHTQAEKNRLQN---AAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGKID 362
            .|.|..::::.::....|...   .|.:..|.|..    |:||:|.|::|:|:||..|:..|.|.
Yeast   206 HLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRI----LFVGNLSFDVTDDLLRKHFQHCGDIV 266

  Fly   363 AIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLM---------------KVGNVT 412
            .|::....::|:.||:.||.:.|.:.:..||:..:..::|||.:               ||.||:
Yeast   267 KIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVS 331

  Fly   413 ERLDMNTTSLDTDE---MDRTGIDLGA 436
            ..   |::|.|...   .||.|.|.|:
Yeast   332 RN---NSSSFDISNNKGYDRAGQDNGS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 22/91 (24%)
RRM2_RBM23_RBM39 337..409 CDD:240730 25/86 (29%)
RBM39linker 425..500 CDD:292157 5/15 (33%)
RRM3_RBM39_like 483..567 CDD:240731
NOP13NP_014224.2 RRM1_Nop13p_fungi 127..217 CDD:409830 22/92 (24%)
RRM2_Nop13p_fungi 241..316 CDD:409831 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.