DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and AT5G03580

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_195978.1 Gene:AT5G03580 / 831785 AraportID:AT5G03580 Length:101 Species:Arabidopsis thaliana


Alignment Length:81 Identity:25/81 - (30%)
Similarity:45/81 - (55%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 PKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKA 392
            |:..|.   ||:.:|...::|:||..:|..|||:....|..|.. |.|:|:.||.:.:||.|.:|
plant    13 PRKFTS---LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFR-GESRGFAFIEFESADSAGRA 73

  Fly   393 LEQLNGFELAGRLMKV 408
            :..::|..:..:::.|
plant    74 MLHMDGRLIGQKILCV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 25/81 (31%)
AT5G03580NP_195978.1 RRM_SF 19..90 CDD:409669 23/72 (32%)

Return to query results.
Submit another query.