DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and AT2G43370

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_850395.1 Gene:AT2G43370 / 818938 AraportID:AT2G43370 Length:333 Species:Arabidopsis thaliana


Alignment Length:217 Identity:52/217 - (23%)
Similarity:73/217 - (33%) Gaps:77/217 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGSGGRKRSGSSPGGGGG-----------HDD------------DYAEN----GPRNGSGGGSSH 62
            ||.||||.||....||..           |:|            .|...    .|....|..|..
plant   155 GGLGGRKESGQLRFGGRDRPFRAPLRPIPHEDLKKLGIQLPPEGRYMSRTQIPSPPRRKGSVSDR 219

  Fly    63 KKQSKRSRS----------RSGSRDGKSRRDRGNERSSHRDKDKERDRNRDGGDRDRHRREGGDR 117
            :::..|.:|          ||..|...|.|...:..||||.:.|:|:                  
plant   220 EEEYYREKSSVEREEEFKERSSLRSYHSHRSSAHTHSSHRRRSKDRE------------------ 266

  Fly   118 DRERERERERDRSRRSRSRDERGGGGRYGDRDKDRRSRDRRGGSKSLQVDRSRDKRRRSRSRDQQ 182
                  |..|:.||..|....||...|||         |.:|     :|..|:..:|....|.::
plant   267 ------ECSREESRSDRKERARGMEDRYG---------DNKG-----EVSGSKRSKRSEEDRSRK 311

  Fly   183 RKRLSPIRERKRSHSRSRDRNS 204
            |.:..|....:||:  |:|.:|
plant   312 RHKHLPSHHHRRSY--SQDHHS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721
AT2G43370NP_850395.1 RRM_snRNP35 60..150 CDD:409683
U2AF_lg 218..>324 CDD:273727 31/143 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.