DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and SRSF7

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens


Alignment Length:178 Identity:67/178 - (37%)
Similarity:81/178 - (45%) Gaps:25/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SRSRSGSRDGKSRRDRGNERSSHRDKDKERDRNRDGGDR-----DRHRREGGDRDRERERERERD 128
            ||.|.....|..||.|.:...:.|..| ..||..:.|::     |.||.....|.|.|.|...|.
Human    75 SRVRVELSTGMPRRSRFDRPPARRPFD-PNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRS 138

  Fly   129 RSRR-SRSRDERGGGGRYGDRDKDRRSRD---RRGGSKSLQVDRSRDKRR-RSRSRDQQRKRLSP 188
            |.|| ||||          .|.:.||||.   ||..|.||:..||...|| ||.|....|...||
Human   139 RGRRYSRSR----------SRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSP 193

  Fly   189 IRERKRSHSRSRDRNSRRRGTN-SPRRRSPPNGADRTTPTELSPEERD 235
            .|.|.||.|.||.|:||.:..: ||:|...|:|:.|.:   .|||..|
Human   194 SRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRS---ASPERMD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 8/23 (35%)
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 4/12 (33%)
Sufficient for interaction with NXF1 81..98 4/16 (25%)
zf-CCHC 104..119 CDD:395050 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 51/127 (40%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226 33/72 (46%)

Return to query results.
Submit another query.