DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and CG34354

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:332 Identity:74/332 - (22%)
Similarity:121/332 - (36%) Gaps:91/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 ESVALA-LGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHTG------PMRLYVGSLHFNI 346
            :||..| |..:||:        ||:|.::.:..:.....|.:...|      ...::||.|...|
  Fly    51 QSVTAAHLQHNGQQ--------QHSQQQQQQQMSQQQQQQQQQLVGNNSKPEQFHIFVGDLSAEI 107

  Fly   347 TEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVGNV 411
            ....|:..|.|||:|...:::.|.:|.:||||||:::....:|:.|:..:||..|..|.::....
  Fly   108 ETQQLKDAFTPFGEISDCRVVRDPQTLKSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWA 172

  Fly   412 TE-----RLDMNTTSLDTDEMDRT-----------GIDLGATGRL--QLMFKLAEGAG------- 451
            |.     :.|||...|..||:...           ||:...:|.|  :::.|.....|       
  Fly   173 TRKPPATKADMNAKPLTFDEVYNQSSPTNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRV 237

  Fly   452 ----------LAVPQAAANALLATAPQPAPLQQQEVAPSIATQCFILSNMFDPRTETNPTWDVEI 506
                      .:..:||.:|::|.  ....:.||.|      :|               .|..|.
  Fly   238 FKDKGYAFVRFSTKEAATHAIVAV--NNTEINQQPV------KC---------------AWGKES 279

  Fly   507 RDDVLEECAKHGGVLHIHVDTISHTGTVYVKCPSTTTAVLAVNALHGRWFAGRVITAAYVPVINY 571
            .|.             .|:..|: .|.:....|..:.|..|..|.:|:..||    ..|.|...|
  Fly   280 GDP-------------NHMSAIA-GGALAQGFPFGSAAAAAAAAAYGQQVAG----YWYPPAPTY 326

  Fly   572 HTMFPDS 578
            ....|.|
  Fly   327 PAAAPAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 6/21 (29%)
RRM2_RBM23_RBM39 337..409 CDD:240730 24/71 (34%)
RBM39linker 425..500 CDD:292157 16/104 (15%)
RRM3_RBM39_like 483..567 CDD:240731 15/83 (18%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 24/73 (33%)
RRM3_TIA1_like 202..278 CDD:240800 15/98 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.