DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Alyref2

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_062357.3 Gene:Alyref2 / 56009 MGIID:1913144 Length:218 Species:Mus musculus


Alignment Length:121 Identity:33/121 - (27%)
Similarity:53/121 - (43%) Gaps:25/121 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 KNRLQNAAPAFQPKS--------------------HTGPMRLYVGSLHFNITEDMLRGIFEPFGK 360
            :||   .||..:||.                    .|| .:|.|.:|.|.:::..::.:|..||.
Mouse    40 RNR---PAPYSRPKPLPDKWQHDLFDSGCGGGEGVETG-AKLLVSNLDFGVSDADIQELFAEFGT 100

  Fly   361 IDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVGNVTERLD 416
            :....:..| .:|||.|...:.:....||.||::|..|..|.||.|.:..||.::|
Mouse   101 LKKAAVDYD-RSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVTSQID 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 33/121 (27%)
Alyref2NP_062357.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 6/17 (35%)
FYTT 3..>32 CDD:462082
Sufficient for RNA-binding, interaction with NXF1-NXT1 16..37
Interaction with HHV-8 ORF57 protein and with ICP27 from HHV-1 54..155 26/102 (25%)
RRM_THOC4 75..149 CDD:410081 22/74 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..218 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.