DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Rbp6

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:111/256 - (43%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SPEE--RDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVA 292
            ||.|  .|...:|...||.:.....|.::|...|.:.:..::....|:|.:|..::.|.||.||.
  Fly    20 SPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVD 84

  Fly   293 LALGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAF----QPKSHTGPMRLYVGSLHFNITEDMLRG 353
                         .::.|.|.....:..:...||    .||..|...:::||.|....|.:.::.
  Fly    85 -------------KVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKS 136

  Fly   354 IFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVGNVTERLDMN 418
            .||.||.|:...|:.|.:|.|.:|:||:|:.:.|...|..| ::..|:..::::......:..|.
  Fly   137 YFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCE-IHFHEINNKMVECKKAQPKEVML 200

  Fly   419 TTSL-DTDEMDRTGIDLGATGRLQLMFKLAEGAGLAVPQAAANALL--ATAPQPAPLQQQE 476
            ..:| .|....|:     |.|.| :::..:.....|...|||..||  :.|...:.||||:
  Fly   201 PANLAKTRAAGRS-----AYGEL-VVWGSSHAHSTAATSAAAAGLLPSSLAAAASVLQQQQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 14/71 (20%)
RRM2_RBM23_RBM39 337..409 CDD:240730 21/71 (30%)
RBM39linker 425..500 CDD:292157 15/54 (28%)
RRM3_RBM39_like 483..567 CDD:240731
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 16/86 (19%)
RRM2_MSI 119..192 CDD:240769 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.