DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and SLIRP1

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:44/76 - (57%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFE 400
            |::||:|.:.:....|||.|..||::.:..:|.|..||.||||||:::::.    .|||::...:
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSL----TALEKIENEQ 76

  Fly   401 ---LAGRLMKV 408
               |.|..:.:
  Fly    77 KHILEGNYLNI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729
RRM2_RBM23_RBM39 337..409 CDD:240730 24/75 (32%)
RBM39linker 425..500 CDD:292157
RRM3_RBM39_like 483..567 CDD:240731
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.