DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Srsf10

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_006239282.1 Gene:Srsf10 / 362630 RGDID:1311067 Length:262 Species:Rattus norvegicus


Alignment Length:156 Identity:51/156 - (32%)
Similarity:68/156 - (43%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KRSRSRSGSRDGKSRRDRG-----NERSSHRDKDKERDRNRDGGDRDRHRREGGDRDRERERERE 126
            :||||||..|    ||.|.     |.|.|:      ..||.....|.|..|...|.||.:.|.|.
  Rat   117 RRSRSRSYER----RRSRSRSFDYNYRRSY------SPRNSRPTGRPRRSRSHSDNDRFKHRNRS 171

  Fly   127 RDRSR---RSRSRDERGGGGRYGDRDKDRRSRDRRGGSKSLQVDRSRDKRRRSRSRDQQRKRLSP 188
            ..||:   ||||:.:.....:...|.:.......||.||:   |.....:..||...:.||: .|
  Rat   172 FSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKT---DSKTHYKSGSRYEKESRKK-EP 232

  Fly   189 IRERKRSHSRSRDRN-SRRRGTNSPR 213
            .|.:.:|.|:||.|: ||.|...||:
  Rat   233 PRSKSQSRSQSRSRSKSRSRSWTSPK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 0/1 (0%)
Srsf10XP_006239282.1 RRM_SF 5..99 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.