DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Pabp2

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:95 Identity:30/95 - (31%)
Similarity:42/95 - (44%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 TTPTEL-SPEERDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRF-KGIAYIEFD 286
            |.|..| ..:|.|.|:|:...:.....|.:||..|...|.:..|.:: |||.... ||.|||||.
  Fly    82 TVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTIL-CNKADGHPKGFAYIEFG 145

  Fly   287 DPESVALALGLSGQRLLGVPIMVQHTQAEK 316
            ..|.|..||.::.....|..|.|...:..:
  Fly   146 SKEFVETALAMNETLFRGRQIKVMSKRTNR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721 30/95 (32%)
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.