DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Hrb27C

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:279 Identity:60/279 - (21%)
Similarity:106/279 - (37%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 EERDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALAL- 295
            ||.:...:|...||......:|..:|...|.:.|..::..|::.|.:|..::.|.||.:|...| 
  Fly     2 EEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ 66

  Fly   296 ----GLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFE 356
                .|.|:.:...|.             |.....:||. .|..::::|.|..|:||..||..|.
  Fly    67 NGPHTLDGRTIDPKPC-------------NPRTLQKPKK-GGGYKVFLGGLPSNVTETDLRTFFN 117

  Fly   357 PFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ----LNGFE----------------- 400
            .:||:..:.::.|.|..:|:|:||:::......:....:    |||.:                 
  Fly   118 RYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRDGSGGQNS 182

  Fly   401 ----LAGRLMKVGNVTERLDMNTTSLDTDEMDRTGIDLGATGRLQLMFKLAEGAGLAVPQAAANA 461
                :.|...|:||.......:...::..:        |..|::       .|..|.:|..|.|.
  Fly   183 NNSTVGGAYGKLGNECSHWGPHHAPINMMQ--------GQNGQM-------GGPPLNMPIGAPNM 232

  Fly   462 L-----LATAPQPAPLQQQ 475
            :     ..|:||    |||
  Fly   233 MPGYQGWGTSPQ----QQQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 18/76 (24%)
RRM2_RBM23_RBM39 337..409 CDD:240730 21/96 (22%)
RBM39linker 425..500 CDD:292157 13/56 (23%)
RRM3_RBM39_like 483..567 CDD:240731
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 19/93 (20%)
RRM2_DAZAP1 94..173 CDD:240773 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.