DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Secp43

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:153 Identity:40/153 - (26%)
Similarity:75/153 - (49%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 VRLITCNKTKRFKGIAYIEF-DDPESVALALGLSGQRLLGV-PIMVQHTQAEKNRLQNAAPAFQP 328
            |||:....|....|..::.| .|..::.....|:|:.:.|. ||:       :.||.:|:.:::.
  Fly    36 VRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKPIPGTNPIV-------RFRLNSASNSYKL 93

  Fly   329 KSHTGPMRLYVGSLHFNITEDMLRGIF-EPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKA 392
            ..:.....::||.|..::.:..|..:| ..|..|...::|:|: .|.||||||:.:...|:.|.|
  Fly    94 PGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDS-LGFSKGYGFVRFGIEDEQKSA 157

  Fly   393 LEQLNGF-ELAGRLMKVGNVTER 414
            |..:||: .|..:.:|:.|...:
  Fly   158 LYDMNGYIGLGTKPIKICNAVPK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 12/45 (27%)
RRM2_RBM23_RBM39 337..409 CDD:240730 24/73 (33%)
RBM39linker 425..500 CDD:292157
RRM3_RBM39_like 483..567 CDD:240731
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 15/60 (25%)
RRM2_SECp43 99..180 CDD:241056 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.