DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and Hnrnpa3

DIOPT Version :10

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_666242.2 Gene:Hnrnpa3 / 229279 MGIID:1917171 Length:379 Species:Mus musculus


Alignment Length:56 Identity:16/56 - (28%)
Similarity:23/56 - (41%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DERKGKDDDDDDEEE-------EEDEMIGPVPTAAGGGATDSRRKKADKEEDDSDD 159
            :||:.:|.:|:...|       |.|..  |:|......:||.......|..||.||
Mouse    37 EERQTRDWEDESSVEKQFSSHPESDRQ--PLPVVMETASTDKSTSSIQKSSDDRDD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 SF-CC1 213..578 CDD:273721
Hnrnpa3NP_666242.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
RRM1_hnRNPA_like 36..113 CDD:409992 16/56 (29%)
RRM2_hnRNPA3 126..205 CDD:409996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225
HnRNPA1 332..>348 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..379
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.