DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caper and lem-2

DIOPT Version :9

Sequence 1:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_496944.1 Gene:lem-2 / 175058 WormBaseID:WBGene00002275 Length:500 Species:Caenorhabditis elegans


Alignment Length:204 Identity:39/204 - (19%)
Similarity:58/204 - (28%) Gaps:66/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PRNGSGGGSSHKKQSKRSRSRSGSRDGKSRRDRGNERSSHRDKDKERDRNRDGGDRDRHRREGGD 116
            |::.....|.....::||..|:.:....|..:....||...:.....|..||..|.|.....   
 Worm    63 PKSAPAPKSPKSPPARRSIPRAAATAANSTINSTFNRSEIEEMSDSDDDMRDDDDDDEEILS--- 124

  Fly   117 RDRERERERERDRSRRSRSRDERGGGGRYGDRDKDRRSRDRRGGSKSLQVDRSRDKRRRSRSRDQ 181
                                            .|.::|..|...|.:..|.|.|.      ....
 Worm   125 --------------------------------PKSKQSSFRSANSTASSVGRGRP------VSST 151

  Fly   182 QRKRLSPIRE----------RKRSHSRSRDRNSRRRGTNSPRR-RSPPN------------GADR 223
            ..|||||:.:          ...|.|::....:..|..::||| .|.|.            |:||
 Worm   152 PNKRLSPVYKPSPVPKNTPRTTSSSSKTTINTTTTRIPSTPRRITSVPGLITDFTPSFSTFGSDR 216

  Fly   224 --TTPTELS 230
              .||...|
 Worm   217 PGATPPRKS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729
RRM2_RBM23_RBM39 337..409 CDD:240730
RBM39linker 425..500 CDD:292157
RRM3_RBM39_like 483..567 CDD:240731
lem-2NP_496944.1 LEM_LAP2_LEMD1 3..>35 CDD:240587
MSC <384..492 CDD:286487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.