DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and TEM1

DIOPT Version :10

Sequence 1:NP_609094.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_013647.1 Gene:TEM1 / 854938 SGDID:S000004529 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:44/159 - (27%)
Similarity:79/159 - (49%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERFRSIT 73
            ::.|||:|.||||.|:.::.|.::......|:||:|:.:.|.:....|...|.|..||..|.::.
Yeast    22 QVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINML 86

  Fly    74 QSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYA-NSKVLKILVGNKTDR--D-DREIPTQIG 134
            ......:..:|.::|::...|...:.:|.|  |.|. |...:.||||.|.|.  | |.|...||.
Yeast    87 PIATVGSSVIIFLFDLTRPETLSSIKEWYR--QAYGLNDSAIPILVGTKYDLLIDLDPEYQEQIS 149

  Fly   135 E---EFAKQHDMYFLETSAKEAENVERLF 160
            .   ::|:..:...:..|..::.|::::|
Yeast   150 RTSMKYAQVMNAPLIFCSTAKSINIQKIF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_609094.1 Rab30 1..168 CDD:133314 44/159 (28%)
TEM1NP_013647.1 Spg1 21..202 CDD:206701 44/159 (28%)

Return to query results.
Submit another query.