DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and RABC2b

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001189850.1 Gene:RABC2b / 820149 AraportID:AT3G09910 Length:205 Species:Arabidopsis thaliana


Alignment Length:214 Identity:85/214 - (39%)
Similarity:129/214 - (60%) Gaps:28/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRF----TQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTA 64
            |...|||:|:|::||||:.|:..|    .:.|.|     ||||||.||.::|.|:::||.|||||
plant    10 YDLSFKILLIGDSGVGKSSLLLSFISSSVEDLAP-----TIGVDFKIKQMKVRGKRLKLTIWDTA 69

  Fly    65 GQERFRSITQSYYRSAHALILVYDISCQPTFDCLPD-WLREIQEYA-NSKVLKILVGNKTDRD-D 126
            |||:||::|.||:|.:..:|||||::.:.||..|.| |.:||:.|: |...:|:|||||.||: :
plant    70 GQEKFRTLTSSYFRGSQGIILVYDVTKRETFLNLADIWAKEIELYSTNHDCIKMLVGNKVDRESE 134

  Fly   127 REIPTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIG-QARSKDGSSSAAAAAAQRQSE 190
            |::..:.|...||..:..|.|.||:..|||...|.|:|.:::. .:..::||||     .:|:.:
plant   135 RKVSREEGMALAKDLNCLFHECSARTRENVNGCFEELALKIMEVPSLLEEGSSS-----VKRKPD 194

  Fly   191 GSSIGLGSFSAKAAQSNCC 209
                      .:|.|..||
plant   195 ----------YRAHQGRCC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 76/170 (45%)
RABC2bNP_001189850.1 PLN03118 1..204 CDD:215587 85/214 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.