DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and rab12

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001018466.1 Gene:rab12 / 553657 ZFINID:ZDB-GENE-050522-555 Length:235 Species:Danio rerio


Alignment Length:183 Identity:86/183 - (46%)
Similarity:120/183 - (65%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQE 67
            |||  .:::::|:.|||||.|:.|||...|.....:|:||||.|||||:.|:||:||||||||||
Zfish    33 DYK--LQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQE 95

  Fly    68 RFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREIPT 131
            ||.|||.:|||.|..::|||||:.|.||:.||.|::.|.:||:.....:|||||.| ..||.|..
Zfish    96 RFNSITSAYYRGAKGIVLVYDITKQETFEDLPKWMKMIDKYASEDAELLLVGNKLDCESDRAISR 160

  Fly   132 QIGEEFAKQ-HDMYFLETSAKEAENVERLFYEIAAELIG----QARSKDGSSS 179
            |..|.||.: ..|.|.|.|||:..||:.:|.::..:::.    :..||:.|:|
Zfish   161 QQAERFASRISGMRFCEASAKDNFNVDEIFLKLVDDILSKMPLEVPSKELSNS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 82/166 (49%)
rab12NP_001018466.1 Rab12 36..235 CDD:206699 83/178 (47%)
RAB 36..200 CDD:197555 79/163 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.