DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and rab30

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001006108.1 Gene:rab30 / 448082 XenbaseID:XB-GENE-479337 Length:203 Species:Xenopus tropicalis


Alignment Length:210 Identity:137/210 - (65%)
Similarity:163/210 - (77%) Gaps:13/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAG 65
            ||||.|||||||:|||||||||||||||||||||||||||||||||||||::|||||||||||||
 Frog     3 MEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGEKIKLQIWDTAG 67

  Fly    66 QERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREI 129
            |||||||||||||||:||||.|||:|:.:|.|||:|||||::||||:|:.:|||||.| .:.||:
 Frog    68 QERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANSEVITVLVGNKIDLAERREV 132

  Fly   130 PTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSSI 194
            ..|..||||...:||:|||||||::|||:||.::|..||.:||.   ::......:....||.||
 Frog   133 SQQRAEEFAGTQNMYYLETSAKESDNVEKLFLDLACRLISEARQ---NALVNNVDSSLPGEGKSI 194

  Fly   195 GLGSFSAKAAQSNCC 209
                     ...|||
 Frog   195 ---------TYLNCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 126/167 (75%)
rab30NP_001006108.1 Rab30 3..171 CDD:133314 126/167 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 248 1.000 Domainoid score I2101
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22815
Inparanoid 1 1.050 270 1.000 Inparanoid score I2944
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0007336
OrthoInspector 1 1.000 - - oto103718
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4448
SonicParanoid 1 1.000 - - X5453
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.